Ataxin 1 Antibody (S76-8), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals NBP2-42186-0.025mg

Product Code. 18664816

Description

Ataxin 1 Monoclonal antibody specifically detects Ataxin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Specifications

• Antigen: Ataxin 1
• Classification: Monoclonal
• Concentration: 1 mg/mL
• Dilution: Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:100, Immunoprecipitation
• Gene Accession No.: P54254
• Host Species: Mouse
• Purification Method: Protein G purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6310
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG2b

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
• Clone: S76-8
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.4), 50% Glycerol
• Gene Alias: ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein
• Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
• Quantity: 0.025 mg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified