missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ataxin 1 Antibody (S76-8), Novus Biologicals™

Ataxin 1 Antibody (S76-8), Novus Biologicals™

Product Code. 18664816 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.025 mg
0.1 mg
Unit Size:
0.03mg
0.1mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18664816 0.025 mg 0.03mg
18666556 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18664816 Supplier Novus Biologicals Supplier No. NBP2421860.025mg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Ataxin 1 Monoclonal antibody specifically detects Ataxin 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen Ataxin 1
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Classification Monoclonal
Clone S76-8
Concentration 1 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:100, Immunoprecipitation
Formulation PBS (pH 7.4), 50% Glycerol
Gene Accession No. P54254
Gene Alias ataxin 1, ataxin 1), ataxin-1, ATX1spinocerebellar ataxia 1 (olivopontocerebellar ataxia 1, autosomal dominant, SCA1D6S504E, Spinocerebellar ataxia type 1 protein
Host Species Mouse
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Purification Method Protein G purified
Quantity 0.025 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6310
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.