missing translation for 'onlineSavingsMsg'
Learn More

Astrin Antibody, Novus Biologicals™

Código de producto. 18417271 Tienda Bio Techne Productos
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
25ul
missing translation for 'unitSize'
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18417271 25ul 25µL
18795623 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18417271 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP18526225ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

Astrin Polyclonal specifically detects Astrin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen Astrin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96R06
Gene Alias Astrin, Deepest, hMAP126, MAP126mitotic spindle coiled-coil related protein, mitotic spindle associated protein p126, Mitotic spindle-associated protein p126, sperm associated antigen 5, sperm-associated antigen 5
Gene Symbols SPAG5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSL
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, MAP Kinase Signaling, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10615
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.