missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASTE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ASTE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASTE1 Polyclonal specifically detects ASTE1 in Mouse samples. It is validated for Western Blot.Specifications
| ASTE1 | |
| Polyclonal | |
| Rabbit | |
| NP_079927 | |
| 28990 | |
| Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| asteroid homolog 1 (Drosophila), HT001, MGC129980, protein asteroid homolog 1 | |
| ASTE1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title