ASPM Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92395-0.02ml

Product Code. 18693690

Description

ASPM Polyclonal antibody specifically detects ASPM in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: ASPM
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Gene Alias: ASP, asp (abnormal spindle) homolog, microcephaly associated (Drosophila), Asp homolog, Calmbp1, FLJ43117, MCPH5DKFZp686N06184, microcephaly associated (Drosophila), microcephaly, primary autosomal recessive 5
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ASPM (NP_060606.3). IFEELVEMKSNYYSFIKQNNPKFSAVQDISSHSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKEDFHSYLPIIDP
• Quantity: 0.02 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 259266
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG