missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASPDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ASPDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASPDH Polyclonal specifically detects ASPDH in Human samples. It is validated for Western Blot.Specifications
| ASPDH | |
| Polyclonal | |
| Rabbit | |
| A6ND91 | |
| 554235 | |
| Synthetic peptides corresponding to LOC554235(hypothetical protein LOC554235) The peptide sequence was selected from the middle region of LOC554235. Peptide sequence LRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| aspartate dehydrogenase domain containing, Aspartate dehydrogenase domain-containing protein, EC 1.4.1.21, putative L-aspartate dehydrogenase | |
| ASPDH | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title