Aspartate beta hydroxylase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10339-100UL

Product Code. 18313194

Description

Aspartate beta hydroxylase Polyclonal specifically detects Aspartate beta hydroxylase in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: Aspartate beta hydroxylase
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: AAH, ASP beta-hydroxylase, aspartate beta-hydroxylaseA beta H-J-J, aspartyl/asparaginyl-beta-hydroxylase, BAH, cardiac junctin, CASQ2BP1, EC 1.14.11.16, HAAHaspartyl/asparaginyl beta-hydroxylase, humbug, JCTN, junctate, junctin, Peptide-aspartate beta-dioxygenase
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Aspartate beta hydroxylase (NP_115857). Peptide sequence PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
• Quantity: 100 μg
• Research Discipline: Cancer
• Gene ID (Entrez): 444
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified