missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Aspartate Aminotransferase Recombinant Protein Antigen

Artikelnummer. 18245214 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantity:
100 μL
Packungsgröße:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18245214 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18245214 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP257518PEP
 Restricted Item
Estimated Shipment: 20-10-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aspartate Aminotransferase. Source: E.coli Amino Acid Sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ The Aspartate Aminotransferase Recombinant Protein Antigen is derived from E. coli. The Aspartate Aminotransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 2805
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Aspartate Aminotransferase Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A
Gene Symbol GOT1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50901. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

For Research Use Only.

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.