missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASCL1/Mash1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17687-25UL
This item is not returnable.
View return policy
Description
ASCL1/Mash1 Polyclonal antibody specifically detects ASCL1/Mash1 in Human samples. It is validated for Immunofluorescence
Specifications
| ASCL1/Mash1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| achaete-scute complex (Drosophila) homolog-like 1, achaete-scute complex homolog 1 (Drosophila), achaete-scute complex-like 1 (Drosophila), achaete-scute homolog 1, ASH-1, ASH1MASH1, BHLHA46, bHLHa46achaete-scute complex-like 1, Class A basic helix-loop-helix protein 46, hASH1, HASH1achaete scute protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL | |
| 25 μg | |
| Neuroscience | |
| 429 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction