missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ASCC3 Polyclonal antibody specifically detects ASCC3 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | ASCC3 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | activating signal cointegrator 1 complex subunit 3, B630009I04Rik, HELIC1, helicase, ATP binding 1, p200, RNA helicase family |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ASCC3 (NP_071374.1). MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?