missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASB5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ASB5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ASB5 Polyclonal specifically detects ASB5 in Human samples. It is validated for Western Blot.Specifications
| ASB5 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ankyrin repeat and SOCS box containing 5, ankyrin repeat and SOCS box protein 5, ankyrin repeat and SOCS box-containing 5, ASB-5, SOCS box protein ASB-5 | |
| ASB5 | |
| IgG | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8WWX0 | |
| 140458 | |
| Synthetic peptides corresponding to ASB5(ankyrin repeat and SOCS box-containing 5) The peptide sequence was selected from the C terminal of ASB5. Peptide sequence LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title