missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345969

Novus Biologicals™ ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Antibody (3F4), Novus Biologicals™

Product Code. 18345969 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345969 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18345969 Supplier Novus Biologicals™ Supplier No. H00027163M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase Monoclonal antibody specifically detects ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase in Human samples. It is validated for ELISA,Immunoprecipitation,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ASAHL/N-acylethanolamine-hydrolyzing Acid Amidase
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 3F4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055250
Gene Alias Acid ceramidase-like protein, ASAHL, ASAH-like protein, EC 3.5.1.-, N-acylethanolamine acid amidase, N-acylethanolamine-hydrolyzing acid amidase, N-acylsphingosine amidohydrolase (acid ceramidase)-like, N-acylsphingosine amidohydrolase-like, PLT
Host Species Mouse
Immunogen NAAA (NP_055250, 36 a.a. ∽ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERFLPQPFTGEIRGMCD
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27163
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.