ASAH2/N-acylsphingosine Amidohydrolase-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49326-25ul

Product Code. 18663019

Description

ASAH2/N-acylsphingosine Amidohydrolase-2 Polyclonal antibody specifically detects ASAH2/N-acylsphingosine Amidohydrolase-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ASAH2/N-acylsphingosine Amidohydrolase-2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2, BCDase, HNAC1, LCDase, NCDase, N-CDase
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 56624
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified