missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Artemis Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Artemis |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18216382
|
Novus Biologicals
NBP2-56362 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18670828
|
Novus Biologicals
NBP2-56362-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Artemis Polyclonal specifically detects Artemis in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Artemis | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, DNA Repair, Non homologous end joining | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64421 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKDTYSDLKSRDKDVTIVPSTGEPTTLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ASCID, DCLREC1C, DNA cross-link repair 1C, DNA cross-link repair 1C protein, EC 3.1, FLJ36438, hSNM1C, protein artemis, Protein A-SCID, PSO2 homolog, RS-SCID, severe combined immunodeficiency, type a (Athabascan), SNM1 homolog C, SNM1CS. cerevisiae), SNM1-like protein | |
| DCLRE1C | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title