missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals ART4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80507
This item is not returnable.
View return policy
Description
ART4 Polyclonal antibody specifically detects ART4 in Human samples. It is validated for Western Blot
Specifications
| ART4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| ADP-ribosyltransferase 4 (DO blood group), ADP-ribosyltransferase 4 (Dombrock blood group), CD297, CD297 antigen, DODombrock blood group, DOK1ADP-ribosyltransferase 4, Dombrock blood group carrier molecule, EC 2.4.2.31, ecto-ADP-ribosyltransferase 4, Mono(ADP-ribosyl)transferase 4, mono-ADP-ribosyltransferase 4, NAD(P)(+)--arginine ADP-ribosyltransferase 4 | |
| Synthetic peptide directed towards the middle region of human ART4. Peptide sequence TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Cardiovascular Biology, CD Markers, Immunology | |
| 420 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| NP_066549 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction