missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARSH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ARSH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARSH Polyclonal specifically detects ARSH in Human samples. It is validated for Western Blot.Specifications
| ARSH | |
| Polyclonal | |
| Rabbit | |
| Q5FYA8 | |
| 347527 | |
| Synthetic peptides corresponding to ARSH(arylsulfatase family, member H) The peptide sequence was selected from the middle region of ARSH. Peptide sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| arylsulfatase family, member H, arylsulfatase H, ASH, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.2, sulfatase | |
| ARSH | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title