ARSE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-68904

Código de producto. 18658888

Descripción

ARSE Polyclonal antibody specifically detects ARSE in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Especificaciones

• Antigen: ARSE
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: arylsulfatase E, arylsulfatase E (chondrodysplasia punctata 1), ASE, CDPX, CDPX1, CDPXR, chondrodysplasia punctata 1, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.2, MGC163310
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF
• Quantity: 100 μg
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 415
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified