ARRDC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP3-17468-25UL

Código de producto. 18387382

Descripción

ARRDC2 Polyclonal antibody specifically detects ARRDC2 in Human samples. It is validated for Immunofluorescence

Especificaciones

• Antigen: ARRDC2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: arrestin domain containing 2, arrestin domain-containing protein 2, CLONE24945, PP2703
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27106
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG