missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARP10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ARP10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18360974 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18360974 25 μg 25µL
18390474 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Produktkod. 18360974 Leverantör Novus Biologicals Leverantörsnummer NBP31721525UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

ARP10 Polyclonal antibody specifically detects ARP10 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen ARP10
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias APOBEC-related protein 10, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H, ARP-10, ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H, DNA dC->dU-editing enzyme APOBEC-3H, EC 3.5.4.-
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: AETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFI
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 164668
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.