missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Aromatase Monoclonal antibody specifically detects Aromatase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Aromatase |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 5C5N7 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | ARO1EC 1.14.14.1, Aromatase, AROsubfamily XIX (aromatization of androgens), CYARMGC104309, CYPXIX, cytochrome P450, family 19, subfamily A, polypeptide 1, Cytochrome P-450AROM, Estrogen synthase, microsomal monooxygenase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (P11511). MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?