missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARNTL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ARNTL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARNTL2 Polyclonal specifically detects ARNTL2 in Mouse samples. It is validated for Western Blot.Specifications
| ARNTL2 | |
| Polyclonal | |
| Rabbit | |
| Q2VPD4 | |
| 56938 | |
| Synthetic peptides corresponding to Arntl2 (aryl hydrocarbon receptor nuclear translocator-like 2) The peptide sequence was selected from the C terminal of Arntl2. Peptide sequence PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Aryl hydrocarbon receptor nuclear translocator-like protein 2, Basic-helix-loop-helix-PAS protein MOP9, bHLHe6, BMAL2, Brain and muscle ARNT-like 2, Class E basic helix-loop-helix protein 6, CLIF, CYCLE-like factor, Member of PAS protein 9, MOP9, PAS domain-containing protein 9, PASD9, Transcription Factor BMAL2 | |
| ARNTL2 | |
| IgG | |
| 64 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title