ARID1A Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33201-100ul

Product Code. 30228498

Description

ARID1A Monoclonal antibody specifically detects ARID1A in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: ARID1A
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ARID domain-containing protein 1A, AT rich interactive domain 1A (SWI- like), AT rich interactive domain 1A (SWI-like), AT-rich interactive domain-containing protein 1A, B120SWI-like protein, BAF250a, BAF250SWI/SNF complex protein p270, BM029, brain protein 120, BRG1-associated factor 250, BRG1-associated factor 250a, C10rf4, C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1, chromatin remodeling factor p250, hELD, hOSA1, matrix associated, actin dependent regulator of chromatin, Osa homolog 1, OSA1, OSA1 nuclear protein, P270, SMARCF1, subfamily f, member 1
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1204-1314 of human ARID1A (O14497).,, Sequence:, SMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNP
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8289
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified