missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGEF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57422
This item is not returnable.
View return policy
Description
ARHGEF3 Polyclonal specifically detects ARHGEF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| ARHGEF3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| DKFZP434F2429, Exchange factor found in platelets and leukemic and neuronal tissues, FLJ98126, MGC118905, Rho guanine nucleotide exchange factor (GEF) 3, rho guanine nucleotide exchange factor 3,59.8 kDA protein, RhoGEF protein, XPLNXPLN | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ARHGEF3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK | |
| 100 μL | |
| Signal Transduction | |
| 50650 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction