missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGDIG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ARHGDIG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ARHGDIG Polyclonal specifically detects ARHGDIG in Human samples. It is validated for Western Blot.Specifications
| ARHGDIG | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Rho GDI 3, Rho GDP dissociation inhibitor (GDI) gamma, rho GDP-dissociation inhibitor 3, RhoGDI gamma, Rho-GDI gamma, RHOGDI-3 | |
| ARHGDIG | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q99819 | |
| 398 | |
| Synthetic peptides corresponding to ARHGDIG (Rho GDP dissociation inhibitor (GDI) gamma) The peptide sequence was selected from the N terminal of ARHGDIG. Peptide sequence DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title