missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGAP44 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92492-0.1ml
This item is not returnable.
View return policy
Description
ARHGAP44 Polyclonal antibody specifically detects ARHGAP44 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| ARHGAP44 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Rho GTPase activating protein 44, rho GTPase-activating protein RICH2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 666-772 of human ARHGAP44 (NP_055674.4). MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST | |
| 0.1 mL | |
| GPCR, Signal Transduction | |
| 9912 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction