missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ARHGAP44 Antibody - BSA Free, Novus Biologicals™

ARHGAP44 Antibody - BSA Free, Novus Biologicals™

Product Code. 18600182 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18600182 0.02 mL 0.02mL
18688162 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18600182 Supplier Novus Biologicals Supplier No. NBP2924920.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ARHGAP44 Polyclonal antibody specifically detects ARHGAP44 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ARHGAP44
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias Rho GTPase activating protein 44, rho GTPase-activating protein RICH2
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 666-772 of human ARHGAP44 (NP_055674.4). MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline GPCR, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9912
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.