missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ARF6 Monoclonal antibody specifically detects ARF6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | ARF6 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 9E7T9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | ADP-ribosylation factor 6, DKFZp564M0264 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330). HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?