missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARC/ARG3.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | ARC/ARG3.1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18251991
|
Novus Biologicals
NBP2-58208 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18636778
|
Novus Biologicals
NBP2-58208-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARC/ARG3.1 Polyclonal specifically detects ARC/ARG3.1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ARC/ARG3.1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Neuroscience, Sensory Systems | |
| activity-regulated cytoskeleton-associated protein, ARC/ARG3.1, KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog | |
| ARC | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 23237 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit