missing translation for 'onlineSavingsMsg'
Learn More

ARA54 Antibody, Novus Biologicals™

Product Code. 18358348 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18358348 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18358348 Supplier Novus Biologicals Supplier No. H00009604D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ARA54 Polyclonal antibody specifically detects ARA54 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ARA54
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_899645.1
Gene Alias Androgen receptor-associated protein 54, ARA54androgen receptor associated protein 54, EC 6.3.2.-, HFB30E3 ubiquitin-protein ligase RNF14, ring finger protein 14FLJ26004, TRIAD2, Triad2 protein
Host Species Rabbit
Immunogen RNF14 (NP_899645.1, 1 a.a. - 348 a.a.) full-length human protein. MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 9604
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.