missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-9 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92558-0.1ml
This item is not returnable.
View return policy
Description
Aquaporin-9 Polyclonal antibody specifically detects Aquaporin-9 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Aquaporin-9 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| AQP-9, Aquaglyceroporin-9, aquaporin 9, aquaporin-9, HsT17287, Small solute channel 1, SSC1aquaglyceroporin-9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human Aquaporin-9 (NP_066190.2). SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 366 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
Ser du en mulighed for forbedring?Del en indholdskorrektion