Aquaporin-8 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92557-0.1ml

Product Code. 18646592

Description

Aquaporin-8 Polyclonal antibody specifically detects Aquaporin-8 in Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Aquaporin-8
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
• Gene Alias: AQP-8, aquaporin 8, aquaporin-8
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Aquaporin-8 (NP_001160.2). MLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILA
• Quantity: 0.1 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 343
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified