Invitrogen™ APRT Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA578804

Product Code. 15964385

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human 293T whole cell, human A549 whole cell, human K562 whole cell. ICC/IF: MCF-7 cell. Flow: A549 cell.

Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Antigen: APRT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Aprt
• Gene Alias: adenine phosphoribosyl transferase; adenine phosphoribosyltransferase; AMP; AMP diphosphorylase; AMP pyrophosphorylase; APRT; APRTD; C85684; DKFZp686D13177; MGC125856; MGC125857; MGC129961; transphosphoribosidase
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 353
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot, Immunocytochemistry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P07741
• Gene Symbols: Aprt
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG