APPL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-76565

Product Code. 18304900

Description

APPL Polyclonal specifically detects APPL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APPL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml
• Gene Alias: Adapter protein containing PH domain, PTB domain and leucine zipper motif 1, adaptor protein containing pH domain, PTB domain and leucine zipper motif 1, adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 1, AKT2 interactor, APPLdip13-alpha, DCC-interacting protein 13-alpha, DIP 13 alpha, DIP13A, Dip13-alpha, DIP13alpha, KIAA1428, signaling adaptor protein DIP13alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: APPL1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
• Quantity: 100 μL
• Gene ID (Entrez): 26060.0
• Target Species: Human
• Isotype: IgG