missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APPBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17802-100UL
This item is not returnable.
View return policy
Description
APPBP2 Polyclonal antibody specifically detects APPBP2 in Human samples. It is validated for Immunohistochemistry (Paraffin)
Specifications
| APPBP2 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW | |
| 100 μg | |
| Cancer | |
| 10513 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction