Abnova™ APP Recombinant Protein

Product Code. 16131731

Brand: Abnova™ H00000351P01.10ug

Description

Human APP full-length ORF recombinant protein with GST-tag at N-terminal

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

• Theoretical MW (kDa): 57.31
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: EVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEED
DSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREKWYKEVHSGQARWLML

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH04369.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 351
• Molecular Weight (g/mol): 57.31
• Name: APP (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: AAA/ABETA/ABPP/AD1/APPI/CTFgamma/CVAP/PN2
• Common Name: APP
• Gene Symbol: APP
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution