missing translation for 'onlineSavingsMsg'
Learn More

Apolipoprotein E R2/ApoE R2 Rabbit anti-Human, Mouse, Rat, Clone: 0V1R8, Novus Biologicals™

Product Code. 18319915 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18319915 20 μg 20µL
18063955 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18319915 Supplier Novus Biologicals Supplier No. NBP31687220UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Apolipoprotein E R2/ApoE R2 Monoclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Apolipoprotein E R2/ApoE R2
Applications Western Blot
Classification Monoclonal
Clone 0V1R8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 864-963 of human Apolipoprotein E R2/ApoE R2 (Q14114). PVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7804
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.