Apolipoprotein E R2/ApoE R2 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92026-0.1ml

Produktkode 18667800

Beskrivelse

Apolipoprotein E R2/ApoE R2 Polyclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Tekniske data

• Antigen: Apolipoprotein E R2/ApoE R2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human Apolipoprotein E R2/ApoE R2 (NP_004622.2). PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
• Quantity: 0.1 mL
• Research Discipline: Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction
• Gene ID (Entrez): 7804
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified