missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein E R2/ApoE R2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92026-0.02ml
This item is not returnable.
View return policy
Description
Apolipoprotein E R2/ApoE R2 Polyclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Apolipoprotein E R2/ApoE R2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1 | |
| A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human Apolipoprotein E R2/ApoE R2 (NP_004622.2). PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP | |
| 0.02 mL | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction | |
| 7804 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction