missing translation for 'onlineSavingsMsg'
Learn More

Apolipoprotein CIII Antibody (8H7), Novus Biologicals™

Product Code. 18328677 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328677 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328677 Supplier Novus Biologicals Supplier No. H00000345M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Apolipoprotein CIII Monoclonal antibody specifically detects Apolipoprotein CIII in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Apolipoprotein CIII
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 8H7
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, ELISA, Immunocytochemistry/ Immunofluorescence 1:10-1:2000
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000031
Gene Alias APOC3, apo-CIII, ApoC-III, APOCIII, Apolipoprotein C3, apolipoprotein C-III, MGC150353
Host Species Mouse
Immunogen APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 345
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.