missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein C1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-91001-0.1ml
This item is not returnable.
View return policy
Description
Apolipoprotein C1 Polyclonal antibody specifically detects Apolipoprotein C1 in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Apolipoprotein C1 | |
| Polyclonal | |
| Immunohistochemistry 1:50-1:100, Immunohistochemistry-Paraffin | |
| APOC1, APOC1B, Apo-CIB, ApoC-IB, Apolipoprotein C1, apolipoprotein C-I | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human APOC1 (NP_001636.1). MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS | |
| 0.1 mL | |
| Cancer, Lipid and Metabolism | |
| 341 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction