missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOL6 Antibody (1F7), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00080830-M03
This item is not returnable.
View return policy
Description
APOL6 Monoclonal antibody specifically detects APOL6 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| APOL6 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| apolipoprotein L, 6, apolipoprotein L6, Apolipoprotein L-VI, APOLVI, APOL-VI, DKFZp667M075, FLJ38562, FLJ90164, MGC57495 | |
| APOL6 (NP_085144.1, 1 a.a. ∽ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTK | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 1F7 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_085144 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 80830 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction