APOL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55075-25ul

Product Code. 18674586

Description

APOL3 Polyclonal specifically detects APOL3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: APOL3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: apoL-III, APOLIII, apolipoprotein L, 3, apolipoprotein L3, Apolipoprotein L-III, CG12_1, CG121, CG12-1, TNF-inducible protein CG12-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: APOL3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 80833
• Target Species: Human
• Isotype: IgG

For Research Use Only