missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3B Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | APOBEC3B |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229724
|
Novus Biologicals
NBP3-33406-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229455
|
Novus Biologicals
NBP3-33406-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
APOBEC3B Monoclonal antibody specifically detects APOBEC3B in Human samples. It is validated for ELISA,Western BlotSpecifications
| APOBEC3B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 9582 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| APOBEC1L, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, ARCD3, ARP4, bK150C2.2, cytidine deaminase, DJ742C19.2, EC 3.5.4, EC 3.5.4.-, FLJ21201, phorbolin 3, Phorbolin-1-related protein, phorbolin-2/3, PHRBNLphorbolin 2, probable DNA dC->dU-editing enzyme APOBEC-3B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human APOBEC3B (NP_004891.5).,, Sequence:, AARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title