Invitrogen™ APLP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA578795

Product Code. 15984375

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Testis Tissue, SGC whole cell, 22RV1 whole cell, MCF-7 whole cell. IHC: Mouse Brain tissue, Rat Brain tissue. Flow: SiHa cell.

This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.

Specifications

• Antigen: APLP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: APLP1
• Gene Alias: amyloid beta (A4) precursor-like protein 1; amyloid beta precursor like protein 1; amyloid precursor-like protein 1; amyloid-like protein 1; APLP; APLP 1; APLP1; APLP-1; Aplp1_retired; APLPAPLP-1; C30; RGD1561211
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11803, 333, 502317
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P51693, Q03157
• Gene Symbols: APLP1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG