missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APBA1 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

APBA1 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Product Code. 18373217 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373217 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18373217 Supplier Novus Biologicals Supplier No. NBP310874100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

APBA1 Polyclonal specifically detects APBA1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.
TRUSTED_SUSTAINABILITY

Specifications

Antigen APBA1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APBA1 (EAW62487). Peptide sequence PPQQQHYVGRHQRGRALEDLRAQLGQEEEERGECLARSASTESGFHNHTD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones, Vision
Primary or Secondary Primary
Gene ID (Entrez) 320
Target Species Human, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.