missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AP4M1 Polyclonal specifically detects AP4M1 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | AP4M1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AP4M1 (NP_004713.2). Peptide sequence LIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?