missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AP3B2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81011
This item is not returnable.
View return policy
Description
AP3B2 Polyclonal specifically detects AP3B2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| AP3B2 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q13367 | |
| AP3B2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQ | |
| 0.1 mL | |
| Neuroscience | |
| 8120 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Adapter-related protein complex 3 subunit beta-2, Adaptor protein complex AP-3 subunit beta-2, adaptor-related protein complex 3, beta 2 subunit, beta-3B-adaptin, Clathrin assembly protein complex 3 beta-2 large chain, DKFZp686D17136, NAPTBAP-3 complex subunit beta-2, Neuronal adaptin-like protein, beta-subunit, Neuron-specific vesicle coat protein beta-NAP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction