missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AP-2 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | AP-2 gamma |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18265634
|
Novus Biologicals
NBP2-55343 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664398
|
Novus Biologicals
NBP2-55343-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AP-2 gamma Polyclonal specifically detects AP-2 gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| AP-2 gamma | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Activating enhancer-binding protein 2 gamma, AP2-GAMMA, ERF1, estrogen receptor factor 1, hAP-2g, TFAP2G, transcription factor AP-2 gamma, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma), transcription factor AP-2 gamma (activating enhancer-binding protein 2 gamma), Transcription factor ERF-1 | |
| TFAP2C | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7022 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title