VENT homeobox homolog (Xenopus laevis), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human VENTX protein.

Brand:  Abnova H00027287-B01P.50ug

Product Code. 16179628

Description

This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq

Sequence: MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

Specifications

• Antigen: VENT homeobox homolog (Xenopus laevis)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human VENTX protein.
• Gene: VENTX
• Gene Alias: HPX42B/MGC119910/MGC119911/NA88A/VENTX2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27287
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_014468.2
• Gene Symbols: VENTX
• Immunogen: VENTX (NP_055283.1, 1 a.a. ∼ 258 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody