VAMP (vesicle-associated membrane protein)-associated protein B and C (D01P), Rabbit anti-Human, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human VAPB protein.

Marke:  Abnova H00009217-D01P.100ug

Artikelnummer. 16100176

Beschreibung

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq

Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL

Spezifikation

• Antigen: VAMP (vesicle-associated membrane protein)-associated protein B and C
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human VAPB protein.
• Gene: VAPB
• Gene Alias: ALS8/VAMP-B/VAMP-C/VAP-B/VAP-C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9217
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004738.3
• Gene Symbols: VAPB
• Immunogen: VAPB (NP_004729.1, 1 a.a. ∼ 243 a.a) full-length human protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody