upstream transcription factor 1, Mouse, Clone: 2A7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant USF1.

Brand:  Abnova H00007391-M02.100ug

Product Code. 16167355

Description

This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGT

Specifications

• Antigen: upstream transcription factor 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_007122
• Gene Symbols: USF1
• Immunogen: USF1 (NP_009053, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2A7
• Description: Mouse monoclonal antibody raised against a partial recombinant USF1.
• Gene: USF1
• Gene Alias: FCHL/FCHL1/HYPLIP1/MLTF/MLTFI/UEF/bHLHb11
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7391
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ